PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 296aa    MW: 34091.7 Da    PI: 6.9178
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34239.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.3e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++  G+g +W + ++++g++R++k+c++rw++yl
       KFK34239.1 14 KGPWSPEEDGKLKSYIETSGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding383.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eE+ ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
       KFK34239.1  69 GGFSEEEENIICNLYLTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.723962IPR017930Myb domain
SuperFamilySSF466893.99E-2511109IPR009057Homeodomain-like
SMARTSM007176.7E-101364IPR001005SANT/Myb domain
PfamPF002494.7E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-231569IPR009057Homeodomain-like
CDDcd001671.26E-61662No hitNo description
PROSITE profilePS5129420.54663117IPR017930Myb domain
SMARTSM007178.1E-1167115IPR001005SANT/Myb domain
PfamPF002497.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370118IPR009057Homeodomain-like
CDDcd001673.77E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDGKLKSYIE TSGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEENIIC NLYLTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLINK  120
QRKELQEACM EQQEMMVMMK RMQQQQIQTT FMMRQDQPMF TWPLQELPHH DQVPTLVMNK  180
NNLFSDQEDV KPSIIKNMVK IEDHEPERTN AFDHLSFSQL LLDPSNNNHL GSEEGCFMNS  240
VTYTNSPLLN THQWFGNFQA EAIDLFSGAT STSADQSTIS WEDISSFVYS DSKQCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195970.0AY519597.1 Arabidopsis thaliana MYB transcription factor (At3g49690) mRNA, complete cds.
GenBankBT0292240.0BT029224.1 Arabidopsis thaliana At3g49690 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404113.10.0hypothetical protein EUTSA_v10010576mg
SwissprotQ9M2Y91e-166RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A087GWI70.0A0A087GWI7_ARAAL; Uncharacterized protein
STRINGBra017963.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29412568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-158myb domain protein 84